KEGG   Bordetella petrii: Bpet2896
Entry
Bpet2896          CDS       T00637                                 
Name
(GenBank) conserved hypothetical protein
  KO
K06997  PLP dependent protein
Organism
bpt  Bordetella petrii
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    Bpet2896
SSDB
Motif
Pfam: Ala_racemase_N CDPS
Other DBs
NCBI-ProteinID: CAP43238
UniProt: A9IS00
LinkDB
Position
3044031..3044813
AA seq 260 aa
MTDSPAYPTATSIDDFRRNLARVREHIAAACQRAGRDPAEVRLLPVSKTVDEARIRLAYA
AGCRELGENKVQEAHAKWEAMADLPDLRWAVIGHLQTNKAKLVARFASEFQALDSLRVAE
ALDRRLQAEGRALDVFVQVNTSNEASKFGLPPEQAAAFVRELPAYSSLRVRGLMTLALFS
PDPALVRPCFVRLRELRDRLRQEAPAGIAIDELSMGMSGDYALAIEEGATTVRVGQAIFG
ARALPDSHYWPGLASAGPQS
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaccgactctcccgcctatcccaccgccacgtccattgacgatttccgccgcaacctc
gcgcgggtgcgcgagcacatcgccgccgcctgccaacgcgccggccgcgatccggccgaa
gtccgcctgttgccggtcagcaagaccgtcgacgaagcccgcatccggctggcctatgcg
gcgggctgccgcgaactcggcgaaaacaaggtgcaagaggcgcacgccaaatgggaagcc
atggccgacctgcccgacctgcgctgggcggtcatcggacacctgcaaaccaacaaggcc
aagctggtggcgcgctttgccagcgagttccaggcgctggacagcctgcgcgtggccgag
gccctcgaccggcgcctgcaggccgaaggccgcgcgctcgatgtattcgtgcaggtgaac
acgtcgaatgaagccagcaagttcgggctgccacccgagcaggcagccgccttcgtgcgc
gagttgccggcctactccagcctgcgcgtgcgcggcctgatgaccctggcgctgttttcg
cccgatccggccctggtgcggccctgcttcgtgcggctgcgcgaactgcgcgaccgcctg
cggcaggaagcgccggccggcatcgcgatcgacgagctttccatgggcatgtcgggcgac
tatgccctggccatcgaagaaggcgccaccacggtgcgcgtaggccaggccattttcgga
gcgcgcgcgctgcccgacagccactactggcccggcctggcgtcggccggcccgcaatca
tga

DBGET integrated database retrieval system