Bordetella petrii: Bpet3931 Help Entry Bpet3931          CDS       T00637                                  Symbol groES Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism bpt  Bordetella petrii Brite KEGG Orthology (KO) [BR:bpt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bpt03110]     Bpet3931 (groES)    03029 Mitochondrial biogenesis [BR:bpt03029]     Bpet3931 (groES) Chaperones and folding catalysts [BR:bpt03110]  Heat shock proteins   HSP10    Bpet3931 (groES) Mitochondrial biogenesis [BR:bpt03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     Bpet3931 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  CAP44277 UniProt:  A9I682 A0ABT7W4J4 LinkDB All DBs Position 4146242..4146529 Genome browser AA seq 95 aa AA seqDB search MALRPLHDRVIVKRLDNERKTASGIVIPDSAAEKPDQGEVVAVGPGKKTEDGKVLPVDLK AGDKVLFGKYAGQSVKVDGEELLVIREEEILAVIQ NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggccctgcgtcccctgcacgatcgcgtgatcgtcaaacgcctggacaacgagcgcaag actgcctcgggcatcgttatccccgacagcgccgctgaaaagccggatcaaggcgaagtg gttgccgttggcccgggcaagaagaccgaagacggcaaagtgctgccggttgacctgaag gctggcgacaaggttctgttcggcaagtatgccggccagtcggtgaaagtcgatggcgaa gagctgctcgtcatccgcgaggaagaaatcctcgccgtgatccagtaa

DBGET integrated database retrieval system