Brachyspira pilosicoli WesB: WESB_0003 Help Entry WESB_0003         CDS       T02412                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism bpw  Brachyspira pilosicoli WesB Pathway bpw02020   Two-component system bpw02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:bpw00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     WESB_0003  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     WESB_0003  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:bpw02035]     WESB_0003 Bacterial motility proteins [BR:bpw02035]  Flagellar system   Flagellar assembly proteins    Others     WESB_0003 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  CCG55476 UniProt:  K0JHE6 LinkDB All DBs Position complement(2324..2620) Genome browser AA seq 98 aa AA seqDB search MTIDKIGGTQNIQFNSKVKYSDKPSQLGSDRIDISNESKIALQNKKLVDIVKQSPDIREE KVAEAKKRLEMYMKDGALRKEVLNSLANSILDVMPIDE NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacaattgataaaataggcggcacacaaaatatacaatttaattctaaagtaaaatat tcagataaaccatctcaattaggttctgatagaattgatatatctaatgaatctaaaata gctttgcaaaataaaaaattagttgatatagttaaacaatctcctgatattagagaagaa aaagttgctgaagctaaaaaaagactagaaatgtatatgaaagatggtgctttaagaaaa gaagtattaaactctttggctaattctattttagatgttatgcctatagatgagtaa

DBGET integrated database retrieval system