Paraburkholderia phenoliruptrix: BUPH_03120 Help Entry BUPH_03120        CDS       T02300                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpx  Paraburkholderia phenoliruptrix Pathway bpx00998   Biosynthesis of various antibiotics bpx01100   Metabolic pathways bpx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BUPH_03120    00074 Mycolic acid biosynthesis     BUPH_03120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BUPH_03120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AFT86694 UniProt:  K0DTV7 LinkDB All DBs Position 1:complement(3077543..3077782) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgcgtcaagaagatcgtcgcagaacaactgggcgtggccgaa gcggaaatcaagaacgaagcttcgttcgtgaacgacctcggcgccgactcgctggacacg gttgaactcgtgatggccctcgaagacgaattcggcatggaaattccggatgaagaagcc gagaagatcaccaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcctaa

DBGET integrated database retrieval system