Paraburkholderia phenoliruptrix: BUPH_03263 Help Entry BUPH_03263        CDS       T02300                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpx  Paraburkholderia phenoliruptrix Pathway bpx00998   Biosynthesis of various antibiotics bpx01100   Metabolic pathways bpx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BUPH_03263    00074 Mycolic acid biosynthesis     BUPH_03263   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BUPH_03263 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Motif Other DBs NCBI-ProteinID:  AFT86836 UniProt:  K0DL74 LinkDB All DBs Position 1:complement(3237664..3237921) Genome browser AA seq 85 aa AA seqDB search MTVSEAEILERIRAIFKENFAIEPESVTPEAHLFEDLDLDSIDAVDLAIKLQEMTGRRIK PEEFKSVRTVGDVIGAVESLLAAQG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccgtgtccgaggcagagattcttgaacgcatccgcgccatcttcaaagaaaacttc gcaatcgagcccgaaagcgtgacgcctgaagcgcatctgttcgaagacctcgatctggac agcatcgacgcagtcgacctcgcgatcaagctgcaggaaatgacggggcgccgcatcaag ccggaagagttcaagtccgtgcgcacggtcggcgacgtgataggcgcggtcgaatcgctg ctcgcggctcaaggctga

DBGET integrated database retrieval system