Paraburkholderia phenoliruptrix: BUPH_03790 Help Entry BUPH_03790        CDS       T02300                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpx  Paraburkholderia phenoliruptrix Pathway bpx00998   Biosynthesis of various antibiotics bpx01100   Metabolic pathways bpx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BUPH_03790    00074 Mycolic acid biosynthesis     BUPH_03790   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BUPH_03790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  AFT87521 UniProt:  K0DMV9 LinkDB All DBs Position 1:3994380..3994607 Genome browser AA seq 75 aa AA seqDB search MEHFYEGMAEILEIDASIVTPELDLHEHNWDSLAVVSTIALVDDCFSVMLSGQALNNCNT IADIEALISTAKKAA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggaacacttttacgaaggcatggccgaaattctcgagatcgacgcaagcatcgttacg ccggagctcgatttgcacgaacacaactgggattcgctcgcggtggtgtcgacgattgca ctcgtcgacgactgcttcagcgtgatgctgagcggccaggcactgaacaactgcaacacc attgccgacatcgaagcgctgatcagcactgcgaagaaggctgcctga

DBGET integrated database retrieval system