Paraburkholderia phenoliruptrix: BUPH_03875 Help Entry BUPH_03875        CDS       T02300                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism bpx  Paraburkholderia phenoliruptrix Brite KEGG Orthology (KO) [BR:bpx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bpx03032]     BUPH_03875    03036 Chromosome and associated proteins [BR:bpx03036]     BUPH_03875    03400 DNA repair and recombination proteins [BR:bpx03400]     BUPH_03875 DNA replication proteins [BR:bpx03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BUPH_03875 Chromosome and associated proteins [BR:bpx03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BUPH_03875 DNA repair and recombination proteins [BR:bpx03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BUPH_03875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AFT87605 UniProt:  K0DRL6 LinkDB All DBs Position 1:4105860..4106138 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGQTGASKAQTGETLDTLLEVIKKSVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgcaggacagacgggcgccagcaaggctcaa accggtgaaacgctggacacgttgcttgaagtgatcaagaagtctgtgtcgaagggtgac gcggtccagttgatcggcttcggcagctttggttcgggcaagcgcgcagcgcgtacgggt cgcaacccgaagacgggcgaaaccatcaagattccggccgcgaagaccgtcaagttcacg gcaggcaaggcgttcaaggacgcagtcaacaagcgctaa

DBGET integrated database retrieval system