Paraburkholderia phytofirmans PsJN: Bphyt_0566 Help Entry Bphyt_0566        CDS       T00765                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bpy  Paraburkholderia phytofirmans PsJN Pathway bpy00190   Oxidative phosphorylation bpy01100   Metabolic pathways bpy02020   Two-component system Module bpy_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bpy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Bphyt_0566  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Bphyt_0566 Enzymes [BR:bpy01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Bphyt_0566 SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ACD14991 UniProt:  B2SXE6 LinkDB All DBs Position 1:complement(619744..619857) Genome browser AA seq 37 aa AA seqDB search MWYFSWILGIGVALAFGIINVMWLESRRPEDGSRKTR NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcagttggatcctcgggatcggcgtggcgttggcgttcggcattatcaac gtgatgtggctggagtcgcgccggccggaggacggtagccggaagactcgttga

DBGET integrated database retrieval system