Paraburkholderia phytofirmans PsJN: Bphyt_3062 Help Entry Bphyt_3062        CDS       T00765                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism bpy  Paraburkholderia phytofirmans PsJN Pathway bpy00998   Biosynthesis of various antibiotics bpy01100   Metabolic pathways bpy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bphyt_3062    00074 Mycolic acid biosynthesis     Bphyt_3062   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bphyt_3062 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Motif Other DBs NCBI-ProteinID:  ACD17454 UniProt:  B2T690 LinkDB All DBs Position 1:complement(3455875..3456126) Genome browser AA seq 83 aa AA seqDB search MSEAEILERIRAIFKENFAIEPERVTPEAHLFEDLDLDSIDAVDLAIKLQEMTGRRIKPE EFKSVRTVGDVIGAVESLLAAQG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgtccgaggcagagattctggagcgcatccgcgccatcttcaaagagaacttcgctatc gagcccgagcgcgtcacgcccgaggcgcatctgttcgaagacctcgatctcgacagcatc gacgccgtcgacctcgcgatcaaactgcaggaaatgaccgggcgccgcatcaagccggaa gagttcaagtcggtgcgcaccgtcggcgatgtgatcggtgcggtcgaatcgctgctggcg gcacagggctga

DBGET integrated database retrieval system