Paraburkholderia phytofirmans PsJN: Bphyt_3838 Help Entry Bphyt_3838        CDS       T00765                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism bpy  Paraburkholderia phytofirmans PsJN Pathway bpy00998   Biosynthesis of various antibiotics bpy01100   Metabolic pathways bpy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bphyt_3838    00074 Mycolic acid biosynthesis     Bphyt_3838   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bphyt_3838 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ACD18226 UniProt:  B2T7E5 LinkDB All DBs Position 1:4290226..4290453 Genome browser AA seq 75 aa AA seqDB search MESFYEGMAEIFEIDASLITPELDLHEHNWDSLAVVSTIALVDDCFNVMLSGQTLNNCNT IADIEALISTAKKAA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggaaagcttttacgaaggaatggccgaaatcttcgagatcgacgcgagcctgattacg ccggaactcgatttacacgagcacaactgggattcgctcgccgtcgtgtcgacgatcgct ctcgtcgacgactgcttcaacgtgatgctgagcggccagacgttgaacaattgcaacacc atcgccgacatcgaagcactgatcagcacggcgaaaaaagcagcctaa

DBGET integrated database retrieval system