Paraburkholderia phytofirmans PsJN: Bphyt_4145 Help Entry Bphyt_4145        CDS       T00765                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism bpy  Paraburkholderia phytofirmans PsJN Pathway bpy00362   Benzoate degradation bpy00621   Dioxin degradation bpy00622   Xylene degradation bpy01100   Metabolic pathways bpy01120   Microbial metabolism in diverse environments bpy01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:bpy00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     Bphyt_4145    00622 Xylene degradation     Bphyt_4145    00621 Dioxin degradation     Bphyt_4145 Enzymes [BR:bpy01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      Bphyt_4145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  ACD18528 UniProt:  B2TEK7 LinkDB All DBs Position 2:complement(185095..185331) Genome browser AA seq 78 aa AA seqDB search MPIVTIQVTREGSKPGTNAVTADEKARLIAGVSQVLLDVLNKPLAATFVVIEEVDMENWG WGGLPVEAYRKQLAQKPG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcctatcgtcacaattcaggtgacccgcgaaggttccaaacccggcaccaatgccgtc acggccgacgaaaaagccaggctgatcgcaggcgtcagccaggtgctgctggacgtgctg aacaagccgctcgcggcgaccttcgtggttatcgaagaagtggatatggagaactggggc tggggcgggttgccggtcgaggcctatcgcaagcagctcgcccagaagccgggttga

DBGET integrated database retrieval system