Paraburkholderia phytofirmans PsJN: Bphyt_4872 Help Entry Bphyt_4872        CDS       T00765                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism bpy  Paraburkholderia phytofirmans PsJN Pathway bpy00362   Benzoate degradation bpy00621   Dioxin degradation bpy00622   Xylene degradation bpy01100   Metabolic pathways bpy01120   Microbial metabolism in diverse environments bpy01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:bpy00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     Bphyt_4872    00622 Xylene degradation     Bphyt_4872    00621 Dioxin degradation     Bphyt_4872 Enzymes [BR:bpy01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      Bphyt_4872 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 FAZ1_cons Motif Other DBs NCBI-ProteinID:  ACD19237 UniProt:  B2TC17 LinkDB All DBs Position 2:complement(996956..997141) Genome browser AA seq 61 aa AA seqDB search MPTFRIELFEGRSVEQKRQFVEAITKATCESLGVEPNSVDIILTDVKRENWATAGRLWSD A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgcccacgtttcgtatcgaacttttcgaaggccgctcggtggaacagaaacgccagttc gtcgaagccattaccaaggcaacctgcgaatcgctcggcgttgaaccgaattcggtggac attattctgaccgacgtgaaacgcgaaaactgggcaacggccgggcgtttatggtccgac gcctga

DBGET integrated database retrieval system