Bombus pyrosoma: 122566952 Help Entry 122566952         CDS       T07776                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism bpyo  Bombus pyrosoma Pathway bpyo04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bpyo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     122566952  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bpyo04121]     122566952    03400 DNA repair and recombination proteins [BR:bpyo03400]     122566952 Ubiquitin system [BR:bpyo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      122566952    Cul5 complex      122566952 DNA repair and recombination proteins [BR:bpyo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      122566952 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  122566952 NCBI-ProteinID:  XP_043580879 LinkDB All DBs AA seq 117 aa AA seqDB search MDVFLMIRRKNMTIFTDAKDNTTVLELKKIIEGILKIPPVNQQLFNKDNVPMSDSKFLSD YGLTSATAKPQCPALVGLAVRQENGQFEALEMTPFSLPPDLPDVMKSQEANGQEQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctaatgattcgacgaaaaaatatgaccatatttaccgatgccaaggat aataccacagttcttgaacttaaaaaaattatagaaggtatattgaaaataccacctgtg aatcaacagctgttcaataaggacaatgttccaatgtcagatagtaaatttttatctgat tatggactaacatcagcaactgcaaaaccacaatgtcctgcattagtaggattagctgta cgtcaagaaaatggtcaatttgaagctttagagatgacaccattttcattaccacctgat ttaccagatgttatgaaatctcaagaagccaatggacaagaacagtcaccttga

DBGET integrated database retrieval system