Bombus pyrosoma: 122573365 Help Entry 122573365         CDS       T07776                                  Name (RefSeq) dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism bpyo  Bombus pyrosoma Pathway bpyo04814   Motor proteins Brite KEGG Orthology (KO) [BR:bpyo00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     122573365  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bpyo03037]     122573365    04812 Cytoskeleton proteins [BR:bpyo04812]     122573365 Cilium and associated proteins [BR:bpyo03037]  Motile cilia and associated proteins   Dynein arm    122573365 Cytoskeleton proteins [BR:bpyo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      122573365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  122573365 NCBI-ProteinID:  XP_043595548 LinkDB All DBs Position LG12:11461757..11463625 Genome browser AA seq 112 aa AA seqDB search MMEDMQEETQFVVDDVSKIIKEAIEVSIGGNAYQHNKVNQWTSNVVEGCLGNLTKLQKPY KYIVTCTIMQKNGAGLHTASSCYWDNATDGSCTVRWENKTMYCIVSVFGLAI NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgatggaagatatgcaagaagagacccaatttgtggtcgatgatgtaagcaaaattatt aaggaagcgattgaagtatctattgggggaaatgcttatcaacataacaaagtaaaccag tggacctcgaatgttgtcgaaggatgtttgggaaatcttacaaaacttcaaaagccatat aaatatatagtgacttgtactataatgcaaaaaaatggagcaggactgcatactgcaagt tcttgctattgggataatgctactgatggtagttgtacagtgcgttgggaaaacaagaca atgtattgtatcgtttctgtatttggcctagcaatttaa

DBGET integrated database retrieval system