Bombus pyrosoma: 122577125 Help Entry 122577125         CDS       T07776                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bpyo  Bombus pyrosoma Pathway bpyo04013   MAPK signaling pathway - fly bpyo04145   Phagosome bpyo04148   Efferocytosis bpyo04310   Wnt signaling pathway bpyo04517   IgSF CAM signaling bpyo04518   Integrin signaling bpyo04620   Toll-like receptor signaling pathway bpyo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bpyo00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     122577125    04310 Wnt signaling pathway     122577125   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     122577125    04518 Integrin signaling     122577125  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     122577125    04148 Efferocytosis     122577125  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122577125  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     122577125  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bpyo04131]     122577125   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bpyo04147]     122577125    04031 GTP-binding proteins [BR:bpyo04031]     122577125 Membrane trafficking [BR:bpyo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     122577125  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     122577125   Macropinocytosis    Ras GTPases     122577125  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     122577125 Exosome [BR:bpyo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122577125   Exosomal proteins of other body fluids (saliva and urine)    122577125   Exosomal proteins of colorectal cancer cells    122577125   Exosomal proteins of bladder cancer cells    122577125 GTP-binding proteins [BR:bpyo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     122577125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  122577125 NCBI-ProteinID:  XP_043604170 LinkDB All DBs Position LG17:312063..314974 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctatcaaatgtgttgtcgtaggagacggagcagtaggtaaaacatgtctcctc ataagctacactaccaacgctttccctggagaatatattccaactgtatttgacaattat tccgcaaatgttatggtggatggtaaaccaataaatcttggtttatgggacacggcaggc caagaagattatgacagattgagaccattgtcttacccacagacagatgtttttctgata tgcttttcccttgttaaccccgccagttttgaaaatgttcgtgctaaatggtatccagaa gtacgccatcattgtccagctactccaattattttagtagggactaaactagatttacgt gaagacaaagagactattgagcggttaaaagataaaaaacttgcacctattacatatcct cagggtttgtccatggcaaaagagatcggtgctgtaaaatatttagaatgttctgctctt actcagaaaggtttgaaaacagtatttgatgaagcaattcgcgcagtattgtgtcctgtt cttcaagtgaaaccaaaacgcagatgtttccttctataa

DBGET integrated database retrieval system