Bombus pyrosoma: 122577125 Help Entry 122577125         CDS       T07776                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bpyo  Bombus pyrosoma Pathway bpyo04013   MAPK signaling pathway - fly bpyo04145   Phagosome bpyo04148   Efferocytosis bpyo04310   Wnt signaling pathway bpyo04620   Toll-like receptor signaling pathway bpyo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bpyo00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     122577125    04310 Wnt signaling pathway     122577125  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     122577125    04148 Efferocytosis     122577125  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122577125  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     122577125  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bpyo04131]     122577125   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bpyo04147]     122577125    04031 GTP-binding proteins [BR:bpyo04031]     122577125 Membrane trafficking [BR:bpyo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     122577125  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     122577125   Macropinocytosis    Ras GTPases     122577125  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     122577125 Exosome [BR:bpyo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122577125   Exosomal proteins of other body fluids (saliva and urine)    122577125   Exosomal proteins of colorectal cancer cells    122577125   Exosomal proteins of bladder cancer cells    122577125 GTP-binding proteins [BR:bpyo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     122577125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  122577125 NCBI-ProteinID:  XP_043604170 LinkDB All DBs Position LG17:312063..314974 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctatcaaatgtgttgtcgtaggagacggagcagtaggtaaaacatgtctcctc ataagctacactaccaacgctttccctggagaatatattccaactgtatttgacaattat tccgcaaatgttatggtggatggtaaaccaataaatcttggtttatgggacacggcaggc caagaagattatgacagattgagaccattgtcttacccacagacagatgtttttctgata tgcttttcccttgttaaccccgccagttttgaaaatgttcgtgctaaatggtatccagaa gtacgccatcattgtccagctactccaattattttagtagggactaaactagatttacgt gaagacaaagagactattgagcggttaaaagataaaaaacttgcacctattacatatcct cagggtttgtccatggcaaaagagatcggtgctgtaaaatatttagaatgttctgctctt actcagaaaggtttgaaaacagtatttgatgaagcaattcgcgcagtattgtgtcctgtt cttcaagtgaaaccaaaacgcagatgtttccttctataa

DBGET integrated database retrieval system