Burkholderia pyrrocinia: ABD05_03830 Help Entry ABD05_03830       CDS       T03962                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpyr  Burkholderia pyrrocinia Pathway bpyr00998   Biosynthesis of various antibiotics bpyr01100   Metabolic pathways bpyr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpyr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABD05_03830    00074 Mycolic acid biosynthesis     ABD05_03830   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABD05_03830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKM01687 LinkDB All DBs Position 1:complement(827563..827823) Genome browser AA seq 86 aa AA seqDB search MNALEQELATLIIGELNLEDVPLETVTDETPLYGEGFGLDSIDILEIALLISKKYGFELR SDNPDNQKIFATLGALAAYVAAHRTK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgcactggaacaagagctcgccacgctgatcatcggcgaactgaatctcgaagac gtcccgctcgaaacagtgacggacgagaccccgctgtatggcgaaggtttcgggctcgac tccatcgacatcctggaaatcgcgctgctgatctcgaagaaatacggcttcgaactgcgc tcggacaatccggataaccagaagatctttgcgacgctcggcgcgctggccgcgtacgtc gccgcgcatcgcacgaagtga

DBGET integrated database retrieval system