KEGG   Bradyrhizobium quebecense: J4P68_0036380
Entry
J4P68_0036380     CDS       T07890                                 
Symbol
trbJ
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
bqb  Bradyrhizobium quebecense
Pathway
bqb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bqb00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    J4P68_0036380 (trbJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bqb02044]
    J4P68_0036380 (trbJ)
Secretion system [BR:bqb02044]
 Type IV secretion system
  Trb secretion system protein
   J4P68_0036380 (trbJ)
SSDB
Motif
Pfam: DUF4141 Pex24p Hydrolase_6 NBD94
Other DBs
NCBI-ProteinID: UGY02502
LinkDB
Position
7744188..7744919
AA seq 243 aa
MRRLSLLAAAGTVALMLGVTVPARSQWIVFDPDNYVQNVMTAARELQQINNQITSLQNEA
QMLINQAKNLANLPYSSLQQLQSSIQRTQQLLAQAQRIAYDVQQIDRAFSTSYAPATSSQ
SNQLLISNAQSRWQNSYAATQDALRVQAGIVGNLDTNRIQTSALVTSSQSASGALQATQA
GNQILALQAQQLADLTAAAAAQGRAQSLEAAQRASAQDQGREQLRRFLTPGQGYQSSNVQ
MFH
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaggcgtcttagcctgttggcggcggctggcacggtcgcgctgatgctcggcgtcacg
gtacccgcgcggtcgcaatggatcgtcttcgatcccgacaattacgtccagaacgttatg
acggctgcccgggaactccagcagatcaacaatcagatcacctcgttgcagaacgaggcg
cagatgttgatcaaccaggcgaagaacctggcaaacctgccgtattcgtcgctgcagcaa
ctgcaatcatcgatccagcggacccagcaattgctggcccaggctcagcgcatcgcctac
gacgtacagcagatcgatcgcgccttctcgaccagctatgcgccagcgaccagcagccag
tcgaaccagttgctgatctccaacgctcaatcgaggtggcagaattcctatgccgcgacg
caagatgcgctccgcgtccaggccggaatcgttggcaacctcgacaccaaccgcatccag
acgtccgctcttgtaacgtcgagccagagcgccagtggcgccctgcaggcaactcaggcc
ggcaaccagatcctcgcgcttcaagcgcaacaactggccgatctcacggcggccgcggcg
gcgcagggcagggcacagagccttgaagcggctcagcgagcctcggcccaggatcagggc
cgagagcagcttcgtcgctttctgactccggggcagggctatcaatcctccaacgtgcag
atgttccattga

DBGET integrated database retrieval system