Bradyrhizobium quebecense: J4P68_0037185 Help Entry J4P68_0037185     CDS       T07890                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bqb  Bradyrhizobium quebecense Pathway bqb01100   Metabolic pathways bqb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bqb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J4P68_0037185    00074 Mycolic acid biosynthesis     J4P68_0037185   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J4P68_0037185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  UGY02651 LinkDB All DBs Position 7931214..7931453 Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPEKVVDSASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgagattggcgagcgggttaagaagattgtggtcgagcaccttggtgtcgaaccc gagaaggtggtcgatagcgcgagcttcatcgatgacctcggcgccgacagcctcgacacg gtcgagctcgtgatggctttcgaagaagaattcggttgcgagattcccgacgacgccgcg gagacgattctgaccgtgggcgacgcgaccaagtttcttgagaagaacgcgaagagctga

DBGET integrated database retrieval system