Bacillus amyloliquefaciens LL3: LL3_00522 Help Entry LL3_00522         CDS       T01835                                  Name (GenBank) hypothetical protein   KO K06440   similar to spore coat protein Organism bql  Bacillus amyloliquefaciens LL3 Brite KEGG Orthology (KO) [BR:bql00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     LL3_00522 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZNHIT3_C Motif Other DBs NCBI-ProteinID:  AEB62070 LinkDB All DBs Position complement(508150..508347) Genome browser AA seq 65 aa AA seqDB search MARALHELLEIQEMTSFKSLCLTKSKTMKALVSDPHLKEIMQQDVDTSTRQLQEFASILS DQQHE NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgccttacatgaattactcgaaattcaggagatgacgtcttttaaatcactt tgtctgacgaaatccaaaaccatgaaagcgctggtatccgatccgcatctgaaagaaatc atgcagcaggatgtggatacatctactaggcaattgcaggaatttgcctcgattttatct gatcaacagcatgaatga

DBGET integrated database retrieval system