Bacillus amyloliquefaciens LL3: LL3_00906 Help Entry LL3_00906         CDS       T01835                                  Name (GenBank) hypothetical protein   KO K07451   5-methylcytosine-specific restriction enzyme A [EC:3.1.21.-] Organism bql  Bacillus amyloliquefaciens LL3 Brite KEGG Orthology (KO) [BR:bql00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02048 Prokaryotic defense system [BR:bql02048]     LL3_00906 Prokaryotic defense system [BR:bql02048]  Restriction and modification system (R-M system)   Type IV R-M system    LL3_00906 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HNH B Motif Other DBs NCBI-ProteinID:  AEB62449 LinkDB All DBs Position 866765..866962 Genome browser AA seq 65 aa AA seqDB search MITEANTVHHIIALRDDPSRAFDLDNLETICIECHNREHPERSGGEKKKKRNENVFKFYG NNEIS NT seq 198 nt NT seq  +upstreamnt  +downstreamnt ttgataacggaggcaaatacggttcaccatatcattgcattaagggatgatccgagccgg gcgtttgatcttgataatcttgaaacgatctgtatagagtgccacaacagggagcacccg gaaagaagtggtggggagaagaagaaaaaacgcaacgaaaatgttttcaaattctacggg aacaacgaaatcagttaa

DBGET integrated database retrieval system