Bacillus amyloliquefaciens LL3: LL3_03840 Help Entry LL3_03840         CDS       T01835                                  Symbol ywlF Name (GenBank) ribose 5-phosphate epimerase   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism bql  Bacillus amyloliquefaciens LL3 Pathway bql00030   Pentose phosphate pathway bql00051   Fructose and mannose metabolism bql00710   Carbon fixation by Calvin cycle bql01100   Metabolic pathways bql01110   Biosynthesis of secondary metabolites bql01120   Microbial metabolism in diverse environments bql01200   Carbon metabolism bql01230   Biosynthesis of amino acids Module bql_M00004   Pentose phosphate pathway (Pentose phosphate cycle) bql_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:bql00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     LL3_03840 (ywlF)    00051 Fructose and mannose metabolism     LL3_03840 (ywlF)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     LL3_03840 (ywlF) Enzymes [BR:bql01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      LL3_03840 (ywlF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  AEB65366 LinkDB All DBs Position complement(3599754..3600203) Genome browser AA seq 149 aa AA seqDB search MKVAIASDHGGVHIREEIKSLLDELQIEYIDMGCECGGGSVDYSDYAFPVAEKVVSGEVD RGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNVLAMGERVIGPGLAREI AKIWLTTEFTGGRHERRIGKIADYEEKNL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagtagctattgcgtcagatcacggcggcgtccatatccgcgaagaaataaaaagt cttttagatgaattgcagattgaatacattgatatgggctgtgaatgcggcggcggctcg gtcgattattcagactacgcttttccggtagcggaaaaagtggtgagcggcgaagttgac aggggaattttaatttgcggcacaggcatcggcatgagcatttccgctaacaaggtaaaa ggaatacgctgtgcgcttgcgcatgacactttcagcgcaaaagcgacgcgagaacacaat gatacgaatgttcttgcgatgggagaacgcgttatcggcccgggtctggcgcgcgaaatc gcaaaaatctggctgacgactgaatttacgggcggccgccacgaacggcggatcggcaaa atcgcagattacgaagaaaaaaatctgtaa

DBGET integrated database retrieval system