KEGG   Bacillus amyloliquefaciens LL3: LL3_03918
Entry
LL3_03918         CDS       T01835                                 

Gene name
bacA
Definition
(GenBank) Bacilysin biosynthesis protein BacA
  KO
K19546  prephenate decarboxylase [EC:4.1.1.100]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00998  Biosynthesis of various secondary metabolites - part 2
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
Module
bql_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bql00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    LL3_03918 (bacA)
Enzymes [BR:bql01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.100  prephenate decarboxylase
     LL3_03918 (bacA)
SSDB
Motif
Pfam: PDT
Other DBs
NCBI-ProteinID: AEB65443
LinkDB
Position
complement(3674496..3675110)
AA seq 204 aa
MIILDNSIQTKSKAYSISKLITINTLGPEGTSSEYAAKNFITNFTLLQGVNSKLSLHDTF
ESCIEKTLQSPLEYTIVPHAYDGIKHFYMRPDLQLLQIFRCDTPMYGLAVRPDFEYTDDM
LDKAVIVSHPSPINLIKYFTRKDVTFDLVNSTSAAAKRVKDGLSDIALTNELARQKYGLQ
FVKTFKSIPMSWSLFGKGEIHDEN
NT seq 615 nt   +upstreamnt  +downstreamnt
atgattatattggataatagcattcagacgaaaagcaaggcttattcaatatctaaactg
attacgatcaacacgctcggtcctgaagggacaagcagtgagtacgcagcaaaaaacttc
atcaccaattttaccctcctccaaggggtgaacagcaagttatctctgcatgatacattt
gaatcgtgcattgaaaaaacgcttcaaagtccgttggaatacacaattgtgcctcacgcg
tatgacggtattaagcatttctacatgagaccggatctgcagcttctgcaaattttcagg
tgcgacaccccaatgtacggcctggctgtccggcctgattttgaatataccgatgacatg
cttgataaggctgttatcgtatcccacccgtctcctatcaatttgattaagtattttacc
cgtaaagatgtcacgtttgatctggtgaactcaacaagcgcagccgcaaaaagagtgaag
gacggtttgtccgacatcgcgctgacaaatgaactggccagacaaaagtacggccttcaa
tttgtaaaaacatttaaaagcattcccatgagctggtcattattcggaaaaggagagatt
catgatgaaaactaa

DBGET integrated database retrieval system