Bartonella quintana RM-11: RM11_0491 Help Entry RM11_0491         CDS       T02294                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bqr  Bartonella quintana RM-11 Brite KEGG Orthology (KO) [BR:bqr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bqr03032]     RM11_0491    03036 Chromosome and associated proteins [BR:bqr03036]     RM11_0491    03400 DNA repair and recombination proteins [BR:bqr03400]     RM11_0491 DNA replication proteins [BR:bqr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RM11_0491 Chromosome and associated proteins [BR:bqr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RM11_0491 DNA repair and recombination proteins [BR:bqr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RM11_0491 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-GeneID:  13563365 NCBI-ProteinID:  AFR26229 LinkDB All DBs Position 617301..617579 Genome browser AA seq 92 aa AA seqDB search MNKSELVSSVAEKAGVSKAQAGSVIDAFIASVTEALASGGDVRLPGFGSFEISHRAATKG RNPSTGVEINIPARSVPKFSAGKTLKEAVNKK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaataaaagtgaattggttagttccgttgctgagaaggcaggtgtttcgaaagcacag gctggttctgttatcgatgcttttatcgcttctgtaacagaagctttggcgtcaggggga gatgttcgtcttccaggttttggttcttttgaaatttctcatcgtgctgccacaaagggg cgtaatccttcgaccggcgttgaaattaatattccagcgcgttctgtaccaaaattttct gcaggaaaaactcttaaagaagctgttaataaaaaataa

DBGET integrated database retrieval system