Bartonella quintana Toulouse: BQ04540 Help Entry BQ04540           CDS       T00181                                  Symbol acpP1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism bqu  Bartonella quintana Toulouse Pathway bqu01100   Metabolic pathways bqu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bqu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BQ04540 (acpP1)    00074 Mycolic acid biosynthesis     BQ04540 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BQ04540 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  CAF25953 UniProt:  Q6G056 LinkDB All DBs Position 556634..556870 Genome browser AA seq 78 aa AA seqDB search MSDTVERVKKIIVEHLGVNADKVVENASFIDDLGADSLDTVELVMAFEEEFGVEIPDEAA ETIFTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagtagagcgcgttaagaaaattattgtggagcatcttggggttaatgca gataaggtagtagaaaatgcaagctttatcgatgatctaggagcagatagccttgatacg gttgagctcgttatggcttttgaagaagaatttggtgtagaaatcccagatgaagccgct gaaacgattttcacagttggtgatgcagtaaagtttatcgataaagcttctgcatga

DBGET integrated database retrieval system