Bradyrhizobium sp. ORS 278: BRADO1475
Help
Entry
BRADO1475 CDS
T00516
Symbol
cheY
Name
(GenBank) Chemotaxis protein cheY
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
bra
Bradyrhizobium sp. ORS 278
Pathway
bra02020
Two-component system
bra02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
bra00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
BRADO1475 (cheY)
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
BRADO1475 (cheY)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
bra02022
]
BRADO1475 (cheY)
02035 Bacterial motility proteins [BR:
bra02035
]
BRADO1475 (cheY)
Two-component system [BR:
bra02022
]
CheA family
CheA-CheYBV (chemotaxis)
BRADO1475 (cheY)
Bacterial motility proteins [BR:
bra02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
BRADO1475 (cheY)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Motif
Other DBs
NCBI-ProteinID:
CAL75366
LinkDB
All DBs
Position
1583384..1583749
Genome browser
AA seq
121 aa
AA seq
DB search
MRTCLVVDDSSVIRKVARRILEGLDFQIVEAEDGEQALEICKRGLPDAVLLDWNMPVMDG
YEFLGNLRRMPGGDAPKVVFCTTENDVAHIARALHAGANEYIMKPFDKDIVTAKFQEVGL
I
NT seq
366 nt
NT seq
+upstream
nt +downstream
nt
atgagaacgtgtctggtggttgacgactcgagcgtcattcgaaaggtggcccgccgcatc
ctggaaggtctggatttccagatcgtggaggcggaggatggtgagcaggcgctggagatc
tgcaagcgcggcttgcccgatgcggtgctgctcgactggaacatgcccgtcatggacggc
tatgagttcctcggcaatctccgccgcatgcccggcggcgacgcgccgaaggtggtcttt
tgcaccaccgagaacgacgtcgcgcacatcgcgcgcgcactgcacgccggcgccaacgag
tacatcatgaagccgttcgacaaggacatcgtcacggcgaaattccaggaagtcgggctg
atctga
DBGET
integrated database retrieval system