Bradyrhizobium sp. BF49: BF49_0982 Help Entry BF49_0982         CDS       T04337                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism brad  Bradyrhizobium sp. BF49 Pathway brad01100   Metabolic pathways brad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:brad00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BF49_0982    00074 Mycolic acid biosynthesis     BF49_0982   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BF49_0982 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  CUT09902 LinkDB All DBs Position I:complement(1022079..1022318) Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPEKVVDAASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgagattggcgagcgggttaagaagatcgtggtcgaacaccttggtgttgaaccc gagaaggttgtcgacgctgcgagcttcatcgacgacctcggcgccgacagtctggacacc gtcgagctggtgatggcgttcgaagaggaattcggttgcgagattccggacgacgccgcg gaaacgattctcaccgtcggcgacgccacgaagtttctcgagaagaacgcgaagagctaa

DBGET integrated database retrieval system