Bradyrhizobium sp. NDS-1: RX330_23675 Help Entry RX330_23675       CDS       T11383                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bran  Bradyrhizobium sp. NDS-1 Pathway bran00998   Biosynthesis of various antibiotics bran01100   Metabolic pathways bran01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bran00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RX330_23675    00074 Mycolic acid biosynthesis     RX330_23675   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RX330_23675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  WOH71278 LinkDB All DBs Position 4986585..4986827 Genome browser AA seq 80 aa AA seqDB search MKQAEILAKLQEVFDGIFLEKVAAKPELSAADVEEWDSLMQISLVIAVEQKFRVRFRVGE VEAARNLGEFADLIAKRMEA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaagcaggctgagatattggcgaagctgcaggaggtgttcgacgggatattcctggag aaggtcgcggccaagcccgagctctcggcggccgatgtcgaggagtgggactcgctcatg cagatctccctcgtcatcgccgtcgagcagaagtttcgcgtccgatttcgggttggcgag gtcgaggcggcgcgcaacttgggtgagtttgccgatctgatcgcgaaacggatggaggca taa

DBGET integrated database retrieval system