Bradyrhizobium sp. 62B: ML401_18465 Help Entry ML401_18465       CDS       T10244                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bray  Bradyrhizobium sp. 62B Pathway bray00998   Biosynthesis of various antibiotics bray01100   Metabolic pathways bray01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bray00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ML401_18465    00074 Mycolic acid biosynthesis     ML401_18465   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ML401_18465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  WIW43511 LinkDB All DBs Position complement(4119663..4119902) Genome browser AA seq 79 aa AA seqDB search MSDIGERVKKIVVEHLGVEPEKVVDAASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacattggcgagcgggttaagaagatcgtggtcgaacaccttggtgttgaaccc gagaaggttgtcgacgctgcgagcttcatcgacgacctcggcgccgacagtctggacacc gtcgagctggtgatggcgttcgaagaggaattcggttgcgagattccggacgacgccgcg gaaacgattctcaccgtcggcgatgccacgaagtttctcgagaagaacgcgaagagctaa

DBGET integrated database retrieval system