Bradyrhizobium sp. C-145: LRP30_22255 Help Entry LRP30_22255       CDS       T09672                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism braz  Bradyrhizobium sp. C-145 Brite KEGG Orthology (KO) [BR:braz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:braz03032]     LRP30_22255    03036 Chromosome and associated proteins [BR:braz03036]     LRP30_22255    03400 DNA repair and recombination proteins [BR:braz03400]     LRP30_22255 DNA replication proteins [BR:braz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LRP30_22255 Chromosome and associated proteins [BR:braz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LRP30_22255 DNA repair and recombination proteins [BR:braz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LRP30_22255 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 NA37 Motif Other DBs NCBI-ProteinID:  UQR59780 LinkDB All DBs Position 4768837..4769136 Genome browser AA seq 99 aa AA seqDB search MAKKAAAPATITLKHLAADIAESQDLSKKRAEAVLTDMVDLITKHLKKGDRVRIVGLGIL QVRKRAARTGRNPATGEPIHIKASWKVAFRPVKELKEAI NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaaagcagccgctcccgccaccatcacactcaagcacctcgccgctgacatc gcggagagccaggacctctcgaaaaagcgcgccgaagccgtcctgaccgacatggtcgac ctgatcaccaagcacctgaagaagggcgaccgcgtccggatcgtcggtctcggcatcctg caggtccgcaagcgcgccgcccgaaccggccgcaatcccgccaccggcgagccgatccac atcaaggccagctggaaggtcgcattccgcccggtcaaggaactgaaagaggcgatctag

DBGET integrated database retrieval system