KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_08305
Entry
BCCGELA001_08305  CDS       T04273                                 
Name
(GenBank) conjugal transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:brc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BCCGELA001_08305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:brc02044]
    BCCGELA001_08305
Secretion system [BR:brc02044]
 Type IV secretion system
  Trb secretion system protein
   BCCGELA001_08305
SSDB
Motif
Pfam: DUF4141 COG3_N FapA DUF5929
Other DBs
NCBI-ProteinID: AMA56255
LinkDB
Position
1734919..1735650
AA seq 243 aa
MMRLGLLAAAGTVAVVLGTTAPARAQWIVFDPNNYVQNVLTAARELQQINNQITSLQNEA
QMLINQAKNLANLPYSSLQQLQSSIQRTQQLLAQAQRIAYDVQQIDGAFSTSYAPVNGSQ
SNQALITNAQSRWQNSVAAMQDALRVQAGVVGNLDTNRIQTSALVTSSQGASGALQATQA
GNQILALQAQQLADLTAAVAAQGRAQSLEAAQRASAQDQGREQLRRFLTPGQGYQSQDVR
MFH
NT seq 732 nt   +upstreamnt  +downstreamnt
atgatgcgacttggcctattggcggctgctggcaccgtcgcggtggtgcttggtaccacg
gcgcccgcgcgggcgcagtggatcgtctttgaccccaacaattacgttcagaatgtcctg
accgctgcgcgtgagctgcagcagattaataatcagatcacctcgttgcagaacgaggcg
cagatgctcatcaaccaggcaaagaatttggcgaacctgccgtattcatcgttgcagcaa
ctgcaatcctcgatccagcggacccagcaattgttggcccaggcccagcgcatcgcctac
gacgtccagcaaatcgatggcgcattctccaccagctatgcgccggtcaacgggagccag
tccaaccaggcattgatcaccaacgctcaatcgcgttggcaaaattctgtagccgcaatg
caggatgccctccgtgttcaggccggcgtcgtcggcaatctcgacaccaaccgcatacag
acctcagcgcttgtaacatcaagtcagggtgcgagtggcgccctgcaggcaacccaggcg
ggcaatcagatcctcgcccttcaagcgcaacaactcgccgatctcacggctgccgtggcg
gcgcagggcagggcgcagagcctcgaagcagctcagcgcgcctcggcccaagatcagggg
cgagaacagcttcggcggttcctgacgcccggacagggctatcagtctcaagacgtgcgg
atgttccactga

DBGET integrated database retrieval system