Brevundimonas sp. DS20: JL11_02705 Help Entry JL11_02705        CDS       T04101                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism brd  Brevundimonas sp. DS20 Brite KEGG Orthology (KO) [BR:brd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:brd03110]     JL11_02705 Chaperones and folding catalysts [BR:brd03110]  Protein folding catalysts   Protein disulfide isomerase    JL11_02705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_3 Redoxin SH3BGR TATR Thioredoxin_2 GST_N Motif Other DBs NCBI-ProteinID:  ALJ07371 UniProt:  A0A0P0CWR1 LinkDB All DBs Position 561857..562114 Genome browser AA seq 85 aa AA seqDB search MADVVIYTKPGCPYCYSAMALLKKKGVDYHEIVASNDPDKKAEMVEKSGGRMTFPQIFID GQHVGGSDDIHALDRDGKLDPLLTA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt ttggccgacgtcgtcatctacaccaagcccggctgcccctattgctacagcgccatggcg cttctgaagaagaagggagtcgattatcatgagatcgtcgcctccaacgaccccgacaag aaggccgagatggtcgagaagtcgggcgggcgcatgaccttcccccagatcttcatcgac ggtcagcacgtcggcggctcggacgacatccacgccctggaccgcgacggcaagctcgac ccgcttctgacggcctga

DBGET integrated database retrieval system