Brevundimonas sp. AJA228-03: HZ989_12010 Help Entry HZ989_12010       CDS       T09566                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism brea  Brevundimonas sp. AJA228-03 Pathway brea01100   Metabolic pathways brea01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:brea00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HZ989_12010    00074 Mycolic acid biosynthesis     HZ989_12010   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HZ989_12010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QTN18950 LinkDB All DBs Position complement(2394328..2394567) Genome browser AA seq 79 aa AA seqDB search MSDTLERVRKIVIDHLDADPDKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFIDEKTAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgataccctggaacgcgtccgcaagatcgtcatcgaccacctggacgccgatccg gacaaggtcaccgaaaaggccagcttcatcgacgacctgggcgctgactcgctcgacaac gtcgaactggtcatggccttcgaggaagagttcgacatcgagatccccgacgacgccgcc gagcacatccagaccgtcggcgacgcggtgaagttcatcgacgaaaagaccgccgcctaa

DBGET integrated database retrieval system