Brevibacterium sp. JSBI002: LJ362_15890 Help Entry LJ362_15890       CDS       T10795                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism brej  Brevibacterium sp. JSBI002 Brite KEGG Orthology (KO) [BR:brej00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:brej03032]     LJ362_15890    03036 Chromosome and associated proteins [BR:brej03036]     LJ362_15890    03400 DNA repair and recombination proteins [BR:brej03400]     LJ362_15890 DNA replication proteins [BR:brej03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LJ362_15890 Chromosome and associated proteins [BR:brej03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LJ362_15890 DNA repair and recombination proteins [BR:brej03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LJ362_15890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  UZD62118 UniProt:  A0A9E8ATN3 LinkDB All DBs Position complement(3516309..3516596) Genome browser AA seq 95 aa AA seqDB search MAKNRSELVAEVAEKSGLTQKQVSDVLDGVFDVFSDVVAKGEKLTIPGWLSVERTERAAR KGRNPQTGEEIQIKAGYSVKLSAGSKLKGAAGSPN NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaagaaccgcagtgagctcgttgcagaagttgccgagaagtccggcctgacccag aagcaggtctcggacgtgctcgatggtgtcttcgatgtcttctccgacgtcgtggccaag ggcgaaaagctcaccatccccggctggctctccgttgagcgcaccgagcgtgccgctcgc aagggtcgcaacccgcagaccggtgaagagatccagatcaaggccggctactccgtgaag ctgtccgctggttcgaagctgaagggtgccgctggcagcccgaactga

DBGET integrated database retrieval system