Brevibacillus sp. NSP2.1: M655_011500
Help
Entry
M655_011500 CDS
T11251
Name
(GenBank) protease inhibitor I42 family protein
KO
K14475
inhibitor of cysteine peptidase
Organism
brep Brevibacillus sp. NSP2.1
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Inhibitor_I42
Motif
Other DBs
NCBI-ProteinID:
QHZ59138
LinkDB
All DBs
Position
complement(2317987..2318295)
Genome browser
AA seq
102 aa
AA seq
DB search
MAMISTYTLQVQSGQPFAVTLDANPTTGYQWALSNSVDETFLFLQSSEFVPPSQPARIGQ
GGQQRFTFRALRRGVTSLSFKYCRPWEPSDCASFVFYVVTVV
NT seq
309 nt
NT seq
+upstream
nt +downstream
nt
atggcgatgatctcgacttatacgcttcaggtgcagagcggccagccgtttgcggtcacg
ctcgacgcaaatccgacgactgggtaccagtgggcactgtccaattcggtggacgagacg
tttctgtttctgcaatccagtgaatttgttccgccttcgcagcccgctcggattgggcaa
ggcggtcagcagcggttcacttttcgggcgctgcgccggggtgtgacttcgctttcgttc
aagtactgccgtccgtgggagccgtctgattgtgccagctttgttttttatgtcgttacg
gttgtgtga
DBGET
integrated database retrieval system