Brevundimonas sp. 'scallop': E4341_02400 Help Entry E4341_02400       CDS       T09204                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bres  Brevundimonas sp. 'scallop' Pathway bres01100   Metabolic pathways bres01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bres00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E4341_02400    00074 Mycolic acid biosynthesis     E4341_02400   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E4341_02400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIF80621 LinkDB All DBs Position complement(503838..504089) Genome browser AA seq 83 aa AA seqDB search MSENPAERSLSLVTKVIASEFGVDASQITPATVAGDILGWDSFSHGSVILELENEIGTVL PLERTLELQTVGELAQLIEEFLN NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtccgagaatcctgctgaacggtcgttgtcgctggtgacgaaagtcatcgcatcagaa tttggcgtagacgcctcacagatcacaccggcaacggtcgccggtgatatccttggttgg gattcattttcccacggctcagtgatcttggaacttgaaaacgaaattggaacagtcttg cccttggaacgcacattggaactacagaccgtcggcgaacttgctcaattaattgaggag tttctcaattga

DBGET integrated database retrieval system