Brevundimonas sp. 'scallop': E4341_07685 Help Entry E4341_07685       CDS       T09204                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bres  Brevundimonas sp. 'scallop' Pathway bres01100   Metabolic pathways bres01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bres00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E4341_07685    00074 Mycolic acid biosynthesis     E4341_07685   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E4341_07685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QIF81591 LinkDB All DBs Position 1555850..1556089 Genome browser AA seq 79 aa AA seqDB search MSDTLERVRKIVIDHLDADPDKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFIDEKSAG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaccctcgagcgcgttcgcaagatcgtcatcgaccatctggacgccgatccg gacaaggtcaccgaaaaggccagcttcatcgacgacctgggcgccgactcgctcgacaac gtcgagctggtgatggcctttgaagaagaattcgacatcgagatcccggatgacgccgcc gagcacatccagacggtcggcgatgcggtcaagttcatcgacgaaaagtcggccggctga

DBGET integrated database retrieval system