Brevundimonas sp. 'scallop': E4341_14615 Help Entry E4341_14615       CDS       T09204                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bres  Brevundimonas sp. 'scallop' Brite KEGG Orthology (KO) [BR:bres00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bres03032]     E4341_14615    03036 Chromosome and associated proteins [BR:bres03036]     E4341_14615    03400 DNA repair and recombination proteins [BR:bres03400]     E4341_14615 DNA replication proteins [BR:bres03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E4341_14615 Chromosome and associated proteins [BR:bres03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E4341_14615 DNA repair and recombination proteins [BR:bres03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E4341_14615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  QIF82817 LinkDB All DBs Position 2939122..2939400 Genome browser AA seq 92 aa AA seqDB search MTTQAELIAAVAKDAGVSQADAGKVLTAIVENIHSTLKSGGDIRISNLGVFDTADRAERE GRNPATGATIKIAASKAVRFRVSKPLKDAVNG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccactcaagccgaactgatcgccgccgtcgccaaagacgctggtgtttcgcaggcc gacgccggcaaggtgctgaccgcgatcgtcgaaaacatccactcgaccctgaagtcgggc ggcgacatccgcatctcgaacctgggcgtcttcgacaccgctgatcgcgctgagcgcgaa ggccgcaacccggctaccggcgcgaccatcaagatcgccgcctccaaggccgtgcgcttc cgcgtctccaagccgctgaaggacgccgtcaacggctaa

DBGET integrated database retrieval system