Brevundimonas sp. SGAir0440: E7T10_06420 Help Entry E7T10_06420       CDS       T06410                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism brev  Brevundimonas sp. SGAir0440 Pathway brev00190   Oxidative phosphorylation brev01100   Metabolic pathways Module brev_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:brev00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     E7T10_06420  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:brev00194]     E7T10_06420 Photosynthesis proteins [BR:brev00194]  Photosystem and electron transport system   F-type ATPase [OT]    E7T10_06420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QCQ98322 UniProt:  A0A4P8QB08 LinkDB All DBs Position 1319693..1319917 Genome browser AA seq 74 aa AA seqDB search MDAEAAKYIGAGLATLGMIGSALGVGNIFGNFLAGALRNPSAAAGQVGNLFVGAALAEAL GILAFVLGILMIFG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggacgctgaagccgcgaagtacatcggcgctggtctcgccaccctgggcatgatcggt tcggccctgggcgtgggcaacatcttcggcaacttccttgccggcgccctgcgcaacccg tcggccgccgccggccaagtcggcaacctgttcgtcggcgccgctctggccgaagccctg ggcatcctggccttcgtgctcggcatcctgatgatcttcggctga

DBGET integrated database retrieval system