Brevundimonas sp. SGAir0440: E7T10_08725 Help Entry E7T10_08725       CDS       T06410                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism brev  Brevundimonas sp. SGAir0440 Pathway brev01100   Metabolic pathways brev01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:brev00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E7T10_08725    00074 Mycolic acid biosynthesis     E7T10_08725   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E7T10_08725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QCQ98743 UniProt:  A0A4P8QED8 LinkDB All DBs Position 1773744..1773983 Genome browser AA seq 79 aa AA seqDB search MSDTLERVRKIVIDHLDADPDKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFIDEKSAG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaccctcgagcgcgttcgcaagatcgtcatcgaccatctggacgccgatccg gacaaggtcaccgaaaaggccagcttcatcgacgacctgggcgccgactcgctcgacaac gtcgagctggtgatggccttcgaagaagaattcgacatcgagatcccggatgacgccgcc gagcacatccagacggtcggcgatgcggtcaagttcatcgacgaaaagtcggccggctga

DBGET integrated database retrieval system