Bdellovibrio reynosensis: MNR06_03415 Help Entry MNR06_03415       CDS       T08711                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism brey  Bdellovibrio reynosensis Pathway brey01100   Metabolic pathways brey01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:brey00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MNR06_03415 (acpP)    00074 Mycolic acid biosynthesis     MNR06_03415 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MNR06_03415 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UOF02001 LinkDB All DBs Position 739229..739465 Genome browser AA seq 78 aa AA seqDB search MAIHPKVKDIIVEQLGVDPDKVKPEASFIDDLGADSLDIVELVMAMEEEFDLEIPDEDAE KLKTVQDVASYLEKKGKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcaattcatccaaaagtaaaagatatcattgttgagcaattaggcgtagatccagat aaagttaagcctgaagcttcttttatcgacgatcttggcgctgacagcttggatatcgtt gaacttgtgatggcaatggaagaagaattcgatcttgaaattcctgatgaagacgctgaa aagctaaaaacagttcaagacgtagcttcttaccttgagaaaaaaggaaaagcttaa

DBGET integrated database retrieval system