Brevundimonas sp. MF30-B: E4M01_12300 Help Entry E4M01_12300       CDS       T06201                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism brf  Brevundimonas sp. MF30-B Pathway brf01100   Metabolic pathways brf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:brf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E4M01_12300    00074 Mycolic acid biosynthesis     E4M01_12300   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E4M01_12300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QBX38465 LinkDB All DBs Position complement(2437204..2437443) Genome browser AA seq 79 aa AA seqDB search MSDTLERVRKIVIDHLDADPDKVTEKASFIDDLGADSLDNVELVMAFEEEFNIEIPDDAA EHIQTVGDAVKFIDEKSAG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacacgctcgaacgcgtccgcaagatcgtcatcgaccacctggacgccgatccg gacaaggtcactgaaaaggccagcttcatcgacgacctgggcgctgactcgctcgacaac gtcgagctggtgatggccttcgaagaagagttcaacatcgagatccccgacgacgccgcc gagcacatccagacggtcggcgacgctgtgaagttcatcgacgagaagtcggcgggctga

DBGET integrated database retrieval system