Brevundimonas sp. GW460-12-10-14-LB2: A4249_06460 Help Entry A4249_06460       CDS       T04395                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism brg  Brevundimonas sp. GW460-12-10-14-LB2 Brite KEGG Orthology (KO) [BR:brg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:brg03032]     A4249_06460    03036 Chromosome and associated proteins [BR:brg03036]     A4249_06460    03400 DNA repair and recombination proteins [BR:brg03400]     A4249_06460 DNA replication proteins [BR:brg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     A4249_06460 Chromosome and associated proteins [BR:brg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     A4249_06460 DNA repair and recombination proteins [BR:brg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       A4249_06460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  ANC53328 UniProt:  A0A160HWV4 LinkDB All DBs Position complement(1315051..1315326) Genome browser AA seq 91 aa AA seqDB search MTKAELIGRMASAANISRDQAKTALEAFTDGVTESLTRGADVKLIGFGSFVAVDRKAGVA RNPQTGAAVARPASRTARFRPGEGLKSALNG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccaaggcggaactgatcggccggatggctagcgcggcgaacatcagccgcgaccag gccaagacggcgctggaggcgttcacggacggcgtgaccgagtcgctgacgcggggcgcg gacgtgaagctgatcggcttcggcagtttcgtcgccgtggaccgcaaggctggcgtcgcc cgtaacccgcagaccggcgctgccgtcgcgcgcccggcctcgcgcaccgcgcgctttcgc ccgggtgagggtttgaaaagcgccttgaacggttga

DBGET integrated database retrieval system