KEGG Orthology (KO) [BR:brhi00001]
09180 Brite Hierarchies
09181 Protein families: metabolism
01009 Protein phosphatases and associated proteins [BR:brhi01009]
104491611 (GRXCR1)
09182 Protein families: genetic information processing
03110 Chaperones and folding catalysts [BR:brhi03110]
104491611 (GRXCR1)
09183 Protein families: signaling and cellular processes
03037 Cilium and associated proteins [BR:brhi03037]
104491611 (GRXCR1)
Protein phosphatases and associated proteins [BR:brhi01009]
Protein serine/threonine phosphatases
Phosphoprotein phosphatases (PPPs)
Protein phosphatase-1
PP1-interacting proteins (PIPs)
104491611 (GRXCR1)
Chaperones and folding catalysts [BR:brhi03110]
Protein folding catalysts
Protein disulfide isomerase
104491611 (GRXCR1)
Cilium and associated proteins [BR:brhi03037]
Other cilia and associated proteins
Stereociliary proteins
104491611 (GRXCR1)
161 aa
VSTVLEFGRIVIYTTSLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNSDYGKELDERC
RRVCEVPSLPVVFIDGHYLGGAEKILLMNESGELQDLLTKIERVQHPQECLSCGGFGFLP
CSACHGSKMSVFRNCFTDSFKALKCTACNENGLQRCRSCAG
