Brucella sp. 09RB8471: BKD03_08495 Help Entry BKD03_08495       CDS       T06323                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism brj  Brucella sp. 09RB8471 Pathway brj01100   Metabolic pathways brj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:brj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BKD03_08495    00074 Mycolic acid biosynthesis     BKD03_08495   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BKD03_08495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  APX69422 LinkDB All DBs Position 2:complement(497532..497768) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagtttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system