Brucella sp. 09RB8471: BKD03_12455 Help Entry BKD03_12455       CDS       T06323                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism brj  Brucella sp. 09RB8471 Brite KEGG Orthology (KO) [BR:brj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:brj03110]     BKD03_12455 Chaperones and folding catalysts [BR:brj03110]  Protein folding catalysts   Protein disulfide isomerase    BKD03_12455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 GST_N_2 SH3BGR GST_N Thioredoxin_4 Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  APX70083 LinkDB All DBs Position 2:1266557..1266823 Genome browser AA seq 88 aa AA seqDB search MVDVIIYTRPGCPYCARAKALLARKGAEFNEIDASATPELRAEMQERSGRNTFPQIFIGS VHVGGCDDLYALEDEGKLDSLLKTGKLI NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggttgacgtcatcatctatacccgtcccggctgcccctattgcgcacgggcaaaggcg cttctggcccgaaagggggccgagttcaatgaaatcgatgcctcggcaacgccggaattg cgcgctgaaatgcaagagcgttccgggcgcaataccttcccgcagatttttatcggctcg gttcatgtcggcggctgtgacgatctttatgcgctggaagatgagggcaagctcgatagc ctgctgaaaaccggcaaacttatttag

DBGET integrated database retrieval system