Bradyrhizobium sp. SK17: CWS35_04315 Help Entry CWS35_04315       CDS       T05325                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism brk  Bradyrhizobium sp. SK17 Brite KEGG Orthology (KO) [BR:brk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:brk03110]     CWS35_04315 (grxC) Chaperones and folding catalysts [BR:brk03110]  Protein folding catalysts   Protein disulfide isomerase    CWS35_04315 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like SH3BGR Motif Other DBs NCBI-ProteinID:  AUC93622 LinkDB All DBs Position 933164..933436 Genome browser AA seq 90 aa AA seqDB search MTAAIEIYTRPGCGYCTAAKSLLTRKNAAFTELNVASNPAYRDEMYDRAGGGATFPQIFI GKTHVGGCDELYALDREGKLDGLLSNGGGA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaccgctgccatcgaaatctacacccgcccgggctgcggttattgcaccgcggccaaa tcgcttttgacgcgcaagaacgccgcgttcaccgaattgaacgtcgccagcaacccggcc taccgcgacgagatgtacgatcgcgccggcggcggggcgaccttcccgcagatcttcatc ggcaagacccatgtcggcggctgcgacgagctctatgcgctcgaccgcgagggcaagctc gacggcctgctcagcaacggaggcggcgcctga

DBGET integrated database retrieval system