Brevundimonas sp. LM2: BZG35_00585 Help Entry BZG35_00585       CDS       T04750                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism brl  Brevundimonas sp. LM2 Brite KEGG Orthology (KO) [BR:brl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:brl03110]     BZG35_00585 Chaperones and folding catalysts [BR:brl03110]  Protein folding catalysts   Protein disulfide isomerase    BZG35_00585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR GST_N Thioredoxin_2 Redoxin Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  AQR60316 UniProt:  A0A1S6EQP4 LinkDB All DBs Position 126178..126435 Genome browser AA seq 85 aa AA seqDB search MADVVLYTKPGCPYCHAAMALLDRKGVDYTEIVASNDPAKKAEMVEKAGGKATFPQIFID GKHIGGSDDMSALDRRGGLDPLLAG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggccgacgtcgtcctctacaccaagcccggttgcccctactgccacgcggccatggcc ctgctggaccgcaagggcgtcgactacaccgagatcgtcgcctccaacgacccggccaag aaggccgagatggtcgaaaaggccggcggcaaggccaccttcccccagatcttcatcgac ggaaaacacatcggcgggtccgacgacatgagcgccctggaccgtcgcggcgggctggac ccgctgctggcgggctga

DBGET integrated database retrieval system