Breoghania sp. L-A4: D1F64_12360 Help Entry D1F64_12360       CDS       T05594                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism brn  Breoghania sp. L-A4 Pathway brn01100   Metabolic pathways brn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:brn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D1F64_12360    00074 Mycolic acid biosynthesis     D1F64_12360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D1F64_12360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  AXS40705 UniProt:  A0A346R2J6 LinkDB All DBs Position complement(2701598..2701834) Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIEHLGVEAEKVTDNASFIDDLGADSLDNVELVMAFEEEFGVEIPDDAA ETIQTVGDAVSFLEKNSA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcggaacgggttaagaagatcgtcatcgagcatctcggcgttgaagcc gagaaagtgaccgacaacgccagcttcatcgacgatcttggcgccgacagcctcgacaac gttgagctggtcatggcttttgaagaagagttcggcgtcgaaatccccgacgatgccgcc gagacgatccagacggttggcgacgccgtcagctttctcgaaaagaactctgcataa

DBGET integrated database retrieval system