Breoghania sp. L-A4: D1F64_13145 Help Entry D1F64_13145       CDS       T05594                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism brn  Breoghania sp. L-A4 Brite KEGG Orthology (KO) [BR:brn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:brn03032]     D1F64_13145    03036 Chromosome and associated proteins [BR:brn03036]     D1F64_13145    03400 DNA repair and recombination proteins [BR:brn03400]     D1F64_13145 DNA replication proteins [BR:brn03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     D1F64_13145 Chromosome and associated proteins [BR:brn03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     D1F64_13145 DNA repair and recombination proteins [BR:brn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       D1F64_13145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AXS40823 UniProt:  A0A346R2W4 LinkDB All DBs Position complement(2892402..2892677) Genome browser AA seq 91 aa AA seqDB search MNKNDLVAAVAEKSGLSKAQAGEAVDGAFEAITETLKGGGEVRIIGFGNFTVSARAATEG RNPRTGETIQIPASKTPKFKAGKGLKDAVNS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaataaaaatgatctcgtcgccgccgtcgctgaaaagagcggcctctcgaaggcccag gctggtgaagccgtggacggtgcctttgaagcgatcaccgagacgctgaagggcggtggt gaagtccggattatcggctttggcaatttcaccgtttccgctcgcgctgcgaccgagggc cgtaacccgcgcaccggcgaaacgatccagatcccggcttccaagacgccgaagttcaag gccggcaagggcctgaaggacgccgtcaacagctag

DBGET integrated database retrieval system