Breoghania sp. L-A4: D1F64_21030 Help Entry D1F64_21030       CDS       T05594                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism brn  Breoghania sp. L-A4 Brite KEGG Orthology (KO) [BR:brn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:brn03110]     D1F64_21030 (grxC) Chaperones and folding catalysts [BR:brn03110]  Protein folding catalysts   Protein disulfide isomerase    D1F64_21030 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin SH3BGR GST_N_3 Glrx-like GST_N_2 YfjL_C Motif Other DBs NCBI-ProteinID:  AXS42029 LinkDB All DBs Position complement(4600748..4601005) Genome browser AA seq 85 aa AA seqDB search MAKIQIYTRQLCGFCTAAKRLLDDKGLEYEEFDATYAPEKRKEMIQRANGRSTFPQIFIG ATHVGGCDELFALDRAGKLSALAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggccaaaatccagatctacacgcgccagctgtgcggcttctgcacggcggcgaagcgg cttcttgacgacaaggggctggagtatgaagaattcgatgcgacctatgcgccggaaaag cgcaaggaaatgattcagcgcgccaacgggcggtcgacatttccgcagatcttcatcggc gcgacccatgtcggcggctgcgacgaacttttcgccctggatcgggccggaaagctctcg gcgctggccgcggcctga

DBGET integrated database retrieval system